Download free
a long exposure photo of a highway at night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
HQ Background Images › Color Backgrounds › Light Backgrounds

a long exposure photo of a highway at night

ig: @danielmonteirox

A map markerBelo Horizonte, Brazil
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
belo horizontebrazilLight backgroundsHd neon wallpapersCar images & picturesbeautyHd red wallpapersurbexHd blue wallpapersspeedcolorfullong exposurephotomovementroadfreewayhighwayvehicletraintransportationPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

RAYONS
615 images · Curated by Renata Kondratetz
rayoncittàurbano
Website 2019
71 images · Curated by Whoosh Whoosh
Website backgroundsHd grey wallpaperstrain
Zazoo
59 images · Curated by Levente Séllei
Light backgroundsHd neon wallpapersHd wallpapers