Download free
white car on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white car on road during daytime

Download this free HD photo of road, car, transportation, and vehicle by Ethan Dow (@ethandow)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
roadCar images & picturestransportationvehicleautomobiletarmacasphalthighwayfreewayspokemachinewheeltirealloy wheelcar wheelLight backgroundsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Following people
346 images · Curated by Daria Nepriakhina 🇺🇦
People images & picturesWomen images & pictureshuman
Faces
122 images · Curated by Mai Knoblovits
facePeople images & picturesman