Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Pauline Loroy's profile
Pauline Loroy
paulinel
Edit image Plus sign for Unsplash+
Download free
woman in black shirt sitting on chair
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

woman in black shirt sitting on chair

Download this free HD photo of girl, pink, night, and light in Amsterdam, Pays-Bas by Pauline Loroy (@paulinel)

A map markerAmsterdam, Pays-Bas
Calendar outlinedPublished on May 20, 2020 (UTC)CameraSafetyFree to use under the Unsplash License
girlpinknightlightpartywinehairsmokedrinkcolorsfashionhumanplantclothingfurniturepurpletablelightingamsterdamapparelPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20