Download free
wide road surround by buildings under white sky
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

wide road surround by buildings under white sky

Atlanta, GA, United States

Calendar outlinedPublished on CameraMotorola, XT1575
SafetyFree to use under the Unsplash License
roadtownHd city wallpapersbuildingtransportationautomobileCar images & pictureshigh risedowntownoffice buildingintersectionmetropolisasphalttarmacfreewayarchitectureLight backgroundstraffic lighthighwayapartment buildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

All Things Good
273 images · Curated by Alexander Eby
buildingurbantown
City/Urban
651 images · Curated by Alexander Eby
Hd city wallpapersurbanbuilding
City
28 images · Curated by Julia Lucas
Hd city wallpapersbuildingurban