Download free
time lapse photography of cars on road during night time
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

time lapse photography of cars on road during night time

Download this free HD photo of mont saint-michel, frankrijk, night, and castles in Le Mont-Saint-Michel, Frankrijk by Tim Rebkavets (@timreb9)

A map markerMont Saint-Michel, Frankrijk
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
mont saint-michelfrankrijknightcastleslong exposurePeople images & pictureshumanroadtarmacasphaltfreewayhighwaypathbuildingbridgeLight backgroundslightingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Maker
130 images · Curated by Luisa Carbonelli
makerHd art wallpaperscraft