Download free
person putting wine on flute glass
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

person putting wine on flute glass

Outdoor champagne in the evening

A map markerTofino, Canada
Calendar outlinedPublished on CameraFUJIFILM, X-T1
SafetyFree to use under the Unsplash License
pouring drinksSummer images & picturessocialjewelryeatingplacematsdrinkschampaignfriendstea lightsflower arrangementnightdishCelebration imagescheersshowerHd holiday wallpapersFamily images & photoseatoutsidePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Still
528 photos · Curated by Anshu A
stillHd grey wallpapersplant
Food
49 photos · Curated by Jessica Majlund
Food images & picturesdrinkFlower images
cosas
32 photos · Curated by Florencia Adobbato
cosadrinkLight backgrounds