Download free
people on park near buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Street Photography
, Film
1,000,000+ Free Images › People Images & Pictures › Attractive Pictures

people on park near buildings

Coral island in the old town

A map markerWanhua District, Taipei, Taiwan
Calendar outlinedPublished on CameraMInolta, RIVA 35
SafetyFree to use under the Unsplash License
analog photoanalogue photoanalog photographyfilm photoshot on filmstreet photographyanalogue photographyfilm photographypavementsidewalkpavement markingwanhualightleaklight trailsun lightLight backgroundsSummer images & picturesstreet viewHd city wallpapersjarPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Akimbo Photos
1,078 images · Curated by Marissa Germain
SchreibtischMöbelPeople images & pictures
Kiosk
17 images · Curated by Annika Tse
kioskbuildingHd city wallpapers