Download free
man standing on mountain
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

man standing on mountain

Download this free HD photo of outdoors, person, director, and travel by Jakob Owens (@jakobowens1)

Calendar outlinedPublished on CameraFUJIFILM, X-Pro2
SafetyFree to use under the Unsplash License
outdoorsPeople images & picturesdirectorTravel imagesphotographervalleyadventure photographerHawaii images & picturesadventureexploreviewfilmmakersfilmmakerhikehikermysteriousmanmaleTree images & pictureshumanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

COOL
212 images · Curated by Bmb oi
Cool images & photoshumanclothing
Aesthetic
129 images · Curated by Aafiya Khan
Hd aesthetic wallpapersroominterior