Download free
houses near body of water during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

houses near body of water during daytime

Download this free HD photo of water, waterfront, port, and dock in Piran, Slovenia by George Bakos (@georgebakos)

A map markerPiran, Slovenia
Calendar outlinedPublished on CameraSONY, ILCE-6300
SafetyFree to use under the Unsplash License
Hd water wallpaperswaterfrontportdockmarinavehiclewatercrafttransportationvesseloutdoorsbuildingNature imagesarchitectureurbanHd city wallpaperstownhumanPeople images & picturespromontoryhousingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Light
423 images · Curated by Jeremy Beck
Light backgroundsSun images & picturesoutdoor
Evening
27 images · Curated by Bhavir Shah
eveninghumanSports images