Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Olivier Miche's profile
Olivier Miche
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
gray steel frame
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

gray steel frame

Bridge

A map markerChancy, Switzerland
Calendar outlinedPublished on January 4, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
darkoutdoorconstructionpinklightswitzerlandcolorriverminimalframecityscapemetalgeometricduskbridgesgenevaironlatecrossingroadPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20