Download free
a red door on a building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Street Photography

a red door on a building

Old Door in the Streets of Lisbon, Portugal, April 2022

A map markerLisbon, Portugal
Calendar outlinedPublished on CameraCanon, EOS 7D
SafetyFree to use under the Unsplash License
portugallisbondoorwallHouse imagesstreetoldLight backgroundswooden doorold doorwoodenshadow wallshadowsunlightwalkwaypathsidewalkpavementflagstonecobblestonePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Minimalistic
1,399 images · Curated by Roman Khabarov
minimalisticnaturdraußen
<3
201 images · Curated by Roman Khabarov
3humanoutdoor