Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Street Photography
, Experimental

Download this free HD photo of street photography, road, light, and flare by Mahdi Bafande (@mahdibafande)

Calendar outlinedPublished on CameraCanon, EOS 800D
SafetyFree to use under the Unsplash License
street photographyroadLight backgroundsflarefreewayhighwayasphalttarmacutility polePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Light Painting
1,699 images · Curated by Rowan Heuvel
Light backgroundsnightStar images
Yellow
5 images · Curated by Mahdi Bafande
Hd yellow wallpapersLight backgroundsflare