Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of building, bridge, handrail, and banister in Singapore, Singapore by mamunur rashid (@babanu)

A map markerSingapore
Calendar outlinedPublished on CameraApple, iPhone 7 Plus
SafetyFree to use under the Unsplash License
buildingbridgehandrailbanisterrailinghumanPeople images & picturespathsingaporepedestrianroadtarmacasphaltwalkwayarchitectureterminalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wet
788 images · Curated by Tim Mossholder
wetoutdoorsea
Night Lights
188 images · Curated by Unsplash Archive
night lightLight backgroundsnight
Unreal
35 images · Curated by Max Bender
unrealHd grey wallpapersoutdoor