Download free
close up photography of concrete brick pavement
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
HQ Background Images › Art Backgrounds

close up photography of concrete brick pavement

Download this free HD photo of grey, wall, stone, and texture by Jo Van de kerkhove (@jokday)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON Df
SafetyFree to use under the Unsplash License
Hd grey wallpaperswallBest stone pictures & imagesTexture backgroundssurfacefacadetokyojapanmacrocloseupdetailpavementwalkwaypathsidewalkcobblestonePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Japan Pics for Website First round
25 images · Curated by Karenna Reidy
japanplantflora
Wallpapers
541 images · Curated by Taylor Vander Meulen
Hd wallpapersrossosfondo