Download free
brown leaf
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

brown leaf

Photography helps people see

A map markerUmm Al Sheif Street, Dubai, United Arab Emirates
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
united arab emiratesdubaiumm al sheif streetLeaf backgroundsphotographyfocusSunset images & picturesplantasphalttarmacpathwalkwaygroundHd yellow wallpapersTree images & picturesmaple leafAnimals images & picturesinsectinvertebratePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Collection #177: Unsplash
8 images · Curated by Unsplash Archive
Hd wallpapersStar imagesnight
Light
548 images · Curated by Shawna Zylenko
Light backgroundsSunset images & picturesoutdoor