Download free
black car on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

black car on road during daytime

Download this free HD photo of Street, path, walkway, and city by fabio menduni (@fabiogsr)

Calendar outlinedPublished on CameraCanon, EOS 77D
SafetyFree to use under the Unsplash License
StreetpathwalkwayHd city wallpaperstownbuildingroadurbanasphalttarmacautomobileCar images & picturestransportationvehiclepavementsidewalkflagstonehumanarchitecturepedestrianPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Ants perspective
77 images · Curated by Hitsch Meyer
outdoorgroundTree images & pictures
Road
648 images · Curated by Iain Moore
roadHd grey wallpapersCar images & pictures
Gnome perspective
30 images · Curated by Gnome Burns
plantoutdoorHd forest wallpapers