Download free
black and white square logo
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

black and white square logo

Download this free HD photo of yellow, urban, street, and sign by the blowup (@theblowup)

Calendar outlinedPublished on CameraApple, iPhone 12 Pro Max
SafetyFree to use under the Unsplash License
Hd yellow wallpapersurbanstreetsignpavementHd city wallpapersmunicipalrepairssidewalktarmacasphaltsymbolrugholeLight backgroundsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Cool Photos
546 images · Curated by L D
photohumanHd grey wallpapers
art
87 images · Curated by VANESSA JOHNSON
Hd art wallpapersHd grey wallpapershuman
Urban Lifestyle
29 images · Curated by sam cos
lifestyleurbanhuman