Download free
a yellow car driving down a street at night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a yellow car driving down a street at night

Download this free HD photo of car, car photography, speed, and orange by Martin Baron (@elmartinbaron)

Calendar outlinedPublished on CameraPanasonic, DC-S5
SafetyFree to use under the Unsplash License
Car images & picturescar photographyspeedHd orange wallpapersracesafetysportcarrenaultBrown backgroundsroadfreewayhighwaywheelmachinespokeWomen images & pictureshumanWedding backgroundsfemalePeople images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

camping
196 images · Curated by Meg Learner
campingoutdoorHd wood wallpapers
Urban Jungle
83 images · Curated by Desiree Templeman
urbanbuildingLight backgrounds