Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Kristijan Arsov's profile
Kristijan Arsov
aarsoph
Edit image Plus sign for Unsplash+
Download free
a large building with columns and a flag on top with Royal Palace of Madrid in the background
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a large building with columns and a flag on top with Royal Palace of Madrid in the background

The Royal Palace in Madrid

A map markerRoyal Palace of Madrid, Calle de Bailén, Madrid, Spain
Calendar outlinedPublished on July 27, 2022 (UTC)CameraSafetyFree to use under the Unsplash License
architecturegreyspainmadridkingpalaceflagsbaroqueroyalkingdomcapitalroyaltycolumnsbuilding exteriorclassicalstunningresidenceneoclassicalroyal palace of madridmonarchyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20