Download free
a couple of people walking down a street next to tall buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a couple of people walking down a street next to tall buildings

Download this free HD photo of building, street, person, and human in Cambridge, United Kingdom by Ebun Oluwole (@ebunoluwole)

A map markerCambridge, Cambridge, United Kingdom
Calendar outlinedPublished on CameraPanasonic, DC-GX880
SafetyFree to use under the Unsplash License
buildingstreetPeople images & pictureshumanpathplantTree images & picturesurbanpavementsidewalktarmacasphaltoutdoorsHd city wallpaperstownrailingroadgardenapartment buildinghigh risePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Magic
86 images · Curated by Ioana M
magicoutdoorLight backgrounds