Download free
a cobblestone street in a european city
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a cobblestone street in a european city

Download this free HD photo of schwedenplatz, avusturya, viyana, and street in Wien, Avusturya by Sercan Faiz (@derrauchfangkehrer)

A map markerSchwedenplatz, Viyana, Avusturya
Calendar outlinedPublished on CameraCanon, EOS 250D
SafetyFree to use under the Unsplash License
schwedenplatzavusturyaviyanastreetwienwalkwaypathtownroadHd city wallpapersurbanbuildinghumanPeople images & picturespavementsidewalkalleyalleywaycobblestonemetropolisPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Neon
223 images · Curated by Unsplash Archive
Hd neon wallpapersLight backgroundssign
Chicago
347 images · Curated by Tom Schenk
Hd chicago wallpapersbuildingunited state