Download free
silhouette of trees near highway with view of rock formation
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

silhouette of trees near highway with view of rock formation

half dome as seen from the glacier point road

Calendar outlinedPublished on CameraSONY, ILCE-6300
SafetyFree to use under the Unsplash License
half domeadventureCalifornia picturesyosemiteoutdoorHd blue wallpapersroadTree images & picturesplantfirabieshighwayfreewaytarmacasphaltoutdoorsNature imagesdirt roadgravelconiferPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

InSHAPE
702 images · Curated by Susan H.
inshapearchitecturebuilding