Download free
cars parked beside brown and white concrete building during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

cars parked beside brown and white concrete building during daytime

Limassol

Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadtarmacasphaltPeople images & picturespathbuildingurbantownpedestrianautomobiletransportationvehiclepavementwheelmachinewalkwayneighborhoodzebra crossingtirePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20