Download free
a city street filled with lots of traffic at night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a city street filled with lots of traffic at night

Download this free HD photo of fast action, street, slow motion, and speed by Ali Shah Lakhani (@alishahlakhani)

Calendar outlinedPublished on CameraFUJIFILM, X-S10
SafetyFree to use under the Unsplash License
fast actionstreetslow motionspeedCar images & picturesroadslong exposuredrivingroadfreewayhighwayasphalttarmaclightingoverpassintersectionPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Fields
53 images · Curated by Brian Stegman
fieldoutdoorGrass backgrounds
NEON
254 images · Curated by Esquimal
Hd neon wallpapersLight backgroundssign