Download free
city building during night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

city building during night

Download this free HD photo of atlanta, city, united states, and jackson street bridge in Atlanta, United States by Joey Kyber (@jtkyber1)

A map markerJackson Street Bridge, Atlanta, United States
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
atlantaHd city wallpapersunited statesjackson street bridgenighturbanbuildingfreewayhighwayskyscraperdowntownroadstreetLight backgroundsoutdoorstownarchitecturehigh riseoverpassintersectionPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Night Lights
188 images · Curated by Unsplash Archive
night lightLight backgroundsnight
Cityscapes
30 images · Curated by 미래 이
cityscapebuildingHd city wallpapers
Atlanta - Cityscapes
6 images · Curated by Audrey Stultz
cityscapeatlantumbuilding