Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Avatar of user Joey Nicotra
Joey Nicotra
📸 Videographer | Photographer 📍 Dallas, TX 🔥 Instagram: Joey.nicotra
A checkmark inside of a circleAvailable for hire
PayPal iconSupport via PayPal
A map markerDallas, TX
Interests
fashionmodelnatureoutdoorstyle
  • A photoPhotos 49
  • A stack of foldersCollections 0
Go to Joey Nicotra's profile
Joey Nicotra
a woman in a garment on a beach
Download
Go to Joey Nicotra's profile
Joey Nicotra
a person holding a cup
Download
Go to Joey Nicotra's profile
Joey Nicotra
a woman taking a picture of herself
Download
Go to Joey Nicotra's profile
Joey Nicotra
a woman with long hair
Download
Go to Joey Nicotra's profile
Joey Nicotra
a woman with her hand on her face
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in white dress shirt and brown hat holding clear drinking glass
Download
Go to Joey Nicotra's profile
Joey Nicotra
woman in white bath robe holding blue ceramic mug
Download
Go to Joey Nicotra's profile
Joey Nicotra
woman holding black and silver camera
Download
Go to Joey Nicotra's profile
Joey Nicotra
woman in white shirt holding camera
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in red and white plaid dress shirt and black pants standing on white snow during
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in black jacket playing guitar
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in gray sweater sitting on brown wooden bench during daytime
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in blue t-shirt holding flag standing on brown rock near body of water during
Download
Go to Joey Nicotra's profile
Joey Nicotra
man in orange hoodie standing
Download
Go to Joey Nicotra's profile
Joey Nicotra
man playing guitar in close up photography
Download
Go to Joey Nicotra's profile
Joey Nicotra
grayscale photo of topless woman
Download
Go to Joey Nicotra's profile
Joey Nicotra
people walking on street during night time
Download
Go to Joey Nicotra's profile
Joey Nicotra
woman with red lipstick and black mascara
Download
Go to Joey Nicotra's profile
Joey Nicotra
woman in black and white striped tank top wearing black hat
Download
Go to Joey Nicotra's profile
Joey Nicotra
person with white cream on face
Download
a woman in a garment on a beach
a woman taking a picture of herself
a woman with her hand on her face
woman holding black and silver camera
man in red and white plaid dress shirt and black pants standing on white snow during
man in gray sweater sitting on brown wooden bench during daytime
man in orange hoodie standing
grayscale photo of topless woman
woman with red lipstick and black mascara
person with white cream on face
a person holding a cup
a woman with long hair
man in white dress shirt and brown hat holding clear drinking glass
woman in white bath robe holding blue ceramic mug
woman in white shirt holding camera
man in black jacket playing guitar
man in blue t-shirt holding flag standing on brown rock near body of water during
man playing guitar in close up photography
people walking on street during night time
woman in black and white striped tank top wearing black hat
a woman in a garment on a beach
a woman with long hair
woman in white shirt holding camera
man in gray sweater sitting on brown wooden bench during daytime
man playing guitar in close up photography
woman with red lipstick and black mascara
woman in black and white striped tank top wearing black hat
a person holding a cup
a woman with her hand on her face
woman holding black and silver camera
man in black jacket playing guitar
man in blue t-shirt holding flag standing on brown rock near body of water during
grayscale photo of topless woman
person with white cream on face
a woman taking a picture of herself
man in white dress shirt and brown hat holding clear drinking glass
woman in white bath robe holding blue ceramic mug
man in red and white plaid dress shirt and black pants standing on white snow during
man in orange hoodie standing
people walking on street during night time

Joey's work appears in the following categories

cameradarkfacefallgrassgreyhandhappyhumanicelandlakelovemanmodelnaturalnatureoceanphotographyportraitroadskinsmilesuntreeusavintagewaterwinterPublic domain images
Unsplash logo

Make something awesome