Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of road, person, human, and automobile in Auckland, New Zealand by Henry Xu (@henry2cute)

A map markerAuckland, New Zealand
Calendar outlinedPublished on CameraApple, iPhone 11 Pro
SafetyFree to use under the Unsplash License
roadPeople images & pictureshumanautomobilevehicletransportationCar images & picturesasphalttarmacurbanintersectionHd city wallpapersStreettownpathhighwaysidewalkpavementneighborhooddowntownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Tranquil
47 images · Curated by Jennifer Ann
tranquiloutdoorSunset images & pictures