Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Ryan Fleischer's profile
Ryan Fleischer
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
Yellow taxis driving on a wet city street
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Yellow taxis driving on a wet city street

Download this free HD photo of vehicle, cityscape, driving, and traffic by Ryan Fleischer (@flyshoot)

Calendar outlinedPublished on January 8, 2026 (UTC)CameraSafetyFree to use under the Unsplash License
vehiclecityscapedrivingtrafficspeedmovementtaximotion blurmotiondynamicblurred backgroundcity lifenight photographycabstreet sceneheadlightsnight drivingcity trafficrush hourabstract motionPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20