Download free
yellow petaled flower on gray brick floor
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

yellow petaled flower on gray brick floor

Delicate flower on the ground

Calendar outlinedPublished on CameraCanon, EOS 7D
SafetyFree to use under the Unsplash License
Flower imagesplantpavementbloomfloorHd floral wallpapersHd color wallpaperspetalcolorfulfreshnaturalfreshnessbokehdaffodilblossomwalkwaypathsidewalkamaryllidaceaesoilPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

flowers
228 images · Curated by Anna-Thea Fab
Flower imagesplantpetal
Flowers
41 images · Curated by Madeleine Boerma
Flower imagesplantflora