Download free
a close up of a penguin with a yellow and black beak
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Animals
, Nature
1,000,000+ Free Images › Feelings Images › Cool Images & Photos

a close up of a penguin with a yellow and black beak

Download this free HD photo of nature, south georgia and the south sandwich islands, penguin, and animal in South Georgia and the South Sandwich Islands by Rod Long (@rodlong)

A map markerSouth Georgia and the South Sandwich Islands
Calendar outlinedPublished on CameraSONY, ILCE-9
SafetyFree to use under the Unsplash License
Nature imagessouth georgia and the south sandwich islandsPenguin pictures & imagesAnimals images & picturesBirds imagessleepingsnoozeasleepsleepnaphideshywildlifeking penguinclothingapparelfootwearshoesockPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

New
7 images · Curated by Ruby Haney
newoutdoorHd wood wallpapers
Animals
16 images · Curated by Melissa Glenn
Animals images & picturesmammalwildlife
Sea animals
437 images · Curated by Adrienn Jensen
sea animalAnimals images & picturessea life