Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Dane Deaner's profile
Dane Deaner
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
woman standing on body of water about to hold person's hand
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

woman standing on body of water about to hold person's hand

Help Across The Water

Calendar outlinedPublished on August 23, 2017 (UTC)CameraSafetyFree to use under the Unsplash License
womansummergreengrasshikingcampingwavehelpsunlightbackpackoutdoorshelpinghatstreamhikescarfexploringcrossingcaucasianpeoplePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20