Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Michaela Kliková's profile
Michaela Kliková
klikovam
Edit image Plus sign for Unsplash+
Download free
wildlife photography of brown horse beside pine tree during daytime
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

wildlife photography of brown horse beside pine tree during daytime

Download this free HD photo of animal, grass, horse, and brown by Michaela Kliková (@klikovam)

Calendar outlinedPublished on August 10, 2019 (UTC)CameraSafetyFree to use under the Unsplash License
animalgrasshorsebrownoutdoorsmammalwildpastureplantgreywildlifefarmfieldgiraffecountrysidemeadowgrasslandruralranchfoalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20