Download free
white sedan near brown concrete church
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white sedan near brown concrete church

Download this free HD photo of spain, past, building, and architecture in Spain by Rebe Pascual (@rebepascual7)

A map markerPast, Spain
Calendar outlinedPublished on CameraHUAWEI, VNS-L31
SafetyFree to use under the Unsplash License
spainpastbuildingarchitecturetowerCar images & picturesautomobilevehiclemachinetirewheelwalkwaypathsteeplealloy wheelcar wheelclock towerHd city wallpapersdowntownurbanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Gaming
70 images · Curated by Eduardo Passos
gaminggiocoelettronica
sport
80 images · Curated by Olga Rafikova
Sports imagesWomen images & pictureshuman