Download free
white canopy tent in middle of forest
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

white canopy tent in middle of forest

Download this free HD photo of wedding, tree, tent, and grey by Nathan Dumlao (@nate_dumlao)

Calendar outlinedPublished on CameraSONY, ILCE-7RM2
SafetyFree to use under the Unsplash License
Wedding backgroundsTree images & picturestentHd grey wallpaperscampingoutdoorswoodlandnorth californiaymcamarriedpathtrackwedding dressTree images & picturesplantlandNature imagesvegetationrainforestredwoodPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Word Partners
74 images · Curated by Amy Ballance
wordhumanHd grey wallpapers
Napureza Nature Board
8 images · Curated by Jobe Michel
plantoutdoorrainforest
Retreat/ unplugged/ relationship
49 images · Curated by Sharon Hicks
figleafeplant