Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Anne Zwagers's profile
Anne Zwagers
puck06
Edit image Plus sign for Unsplash+
Download free
white and brown sheep on lawn grass
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

white and brown sheep on lawn grass

Countryside Sheep

A map markerHoogmade, Netherlands
Calendar outlinedPublished on August 16, 2017 (UTC)CameraSafetyFree to use under the Unsplash License
greenlandanimalslifechurchwhitegreyfarmfieldsheepmeadownetherlandscountryruralpasturedutchbeaststareanimalcountrysidePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20