Download free
white and blue boat on dock during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white and blue boat on dock during daytime

Download this free HD photo of dubai - united arab emirates, boat, transportation, and vehicle in Dubai, United Arab Emirates by Itadaki (@itadakidesu)

A map markerDubai - United Arab Emirates
Calendar outlinedPublished on CameraFUJIFILM, X-T2
SafetyFree to use under the Unsplash License
dubai - united arab emiratesboattransportationvehicleHd water wallpaperswaterfrontwatercraftvesselpierportdockHd grey wallpapersmarinawheelmachineferryharborPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Conceptual
299 images · Curated by Jeremy Beck
conceptualPeople images & picturesman
Interesting Doors
111 images · Curated by Erin Phillips
doorHd windows wallpapersbuilding