Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Paige McDaniel's profile
Paige McDaniel
pmcdaniel17
Edit image Plus sign for Unsplash+
Download free
white and black sheep eating grass beside lake
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

white and black sheep eating grass beside lake

This photo was taken on our way up to the Kylemore Abbey in the Connemara mountains. This was by far the most breath-taking and most unexpected landscape from our trip to Ireland. There were sheep wandering freely which really spoke to the pristine beauty and peacefulness of the area.

A map markerR344, Co. Galway, Ireland, Galway
Calendar outlinedPublished on June 19, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
mountainssceneryfarmlakesheepirelandcountrysidelivestocktramfarm landhornsconnemaraanimalplantgreygrassfieldmeadowgrasslandoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20