Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of hardware, computer keyboard, computer, and computer hardware by Geoffroy Hauwen (@geoffroyh)

Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
hardwarecomputer keyboardHd computer wallpaperscomputer hardwareKeyboard backgroundselectronicssidewalkpavementvehicletransportationautomobileCar images & picturescobblestonemachinehumanPeople images & picturesbusurbanmetropolistownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

London calling
148 images · Curated by Angie Muldowney
londonbuildingHd city wallpapers
Festive Food & Drinks
100 images · Curated by Unsplash+ Collections
drinkfestiveFood images & pictures
Black Friday
49 images · Curated by Alyssa Wright
black fridayshoppingsale