Download free
water falls in the middle of the forest
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

water falls in the middle of the forest

Lower Kalimna Falls plunge into a pool below in the Otway ranges, Victoria.

A map markerLorne VIC, Australia
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750SafetyFree to use under the Unsplash License
australialorne vicnatureriverwaterwaterfallvictoriaotwayscavetreesfernfernsstreampoolforestswoodsforestoutdoorsgreybridgePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20