Download free
vehicles on road beside brown buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

vehicles on road beside brown buildings

Download this free HD photo of path, walkway, pavement, and sidewalk by Ed Leszczynskl (@ed_leszczynskl)

Calendar outlinedPublished on CameraSAMSUNG, NX1000
SafetyFree to use under the Unsplash License
pathwalkwaypavementsidewalktarmacasphaltbuildingurbanHd city wallpapersmetropolistownautomobiletransportationvehicleCar images & picturestowerarchitectureroadoutdoorsoffice buildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Travel
38 images · Curated by Carolyne Stanley
Travel imagesbuildingCar images & pictures
True North Camps
43 images · Curated by Evan Wise
northcampoutdoor