Download free
vehicle on paved road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

vehicle on paved road

Download this free HD photo of grey, road, asphalt, and tarmac by Anne Nygård (@polarmermaid)

Calendar outlinedPublished on CameraCanon, EOS 1300D
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadasphalttarmacCar images & picturesrisegraphicroad markingshoulder linetrafficrear lighttail lightfreewayhighwayplantvegetationtireautomobilevehicletransportationPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Micro Worlds
573 images · Curated by Matt Popovich
aerial viewaerialHd grey wallpapers