Download free
vehicle in road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

vehicle in road during daytime

Download this free HD photo of urban, road, automobile, and vehicle by Imansyah Muhamad Putera (@imansyahmp)

Calendar outlinedPublished on CameraCanon, EOS 70D
SafetyFree to use under the Unsplash License
urbanroadautomobilevehicletransportationintersectionmetropolisbuildingbusasphalttarmacPeople images & pictureshumantruckstreetwheelpedestrianfreewayhigh risevanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Farmland and Fields
495 images · Curated by Kelly Sikkema
farmlandfieldfarm