Download free
vacant road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

vacant road during daytime

Download this free HD photo of grey, path, human, and person by CHUTTERSNAP (@chuttersnap)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON Z 6
SafetyFree to use under the Unsplash License
Hd grey wallpaperspathhumanPeople images & picturestransportationvehiclemachinesidewalkpavementspoketiremealFood images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Rural.
57 images · Curated by milly
ruralbuildingurban
TDD
4 images · Curated by Jen Winson
tddSports imagesHd grey wallpapers