Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Simone Hutsch's profile
Simone Hutsch
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
two teal-and-white skyscrapers
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Architecture, Blue

two teal-and-white skyscrapers

Duplex

A map markerDeloitte Rotterdam, Rotterdam, Netherlands
Calendar outlinedPublished on August 14, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
businesscitybuildinghousebluearchitecturegreyurbancreativegraphicoffice buildingwindowsskyscraperminimalismlinestealrotterdamgeometryhigh risefacadePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20