Download free
two person walking between buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

two person walking between buildings

Picturesque Budapest streets.

A map markerBudapest, Királyi Pál u. 12, 1053 Hungary, Hungary
Calendar outlinedPublished on CameraApple, iPhone XS
SafetyFree to use under the Unsplash License
budapesthungary1053 hungarykirályi pál u. 12picturesque streetbudapest streetcolorful streetpainted houseswalkwaypathpavementsidewalkhumanPeople images & picturesflagstonecobblestoneHd grey wallpaperspedestrianPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Actual Pretty
231 images · Curated by Cinthya Jauregui
outdoorhungaryHd wallpapers
skandi collection
158 images · Curated by lauren pis
buildingswedenHouse images
The Way
111 images · Curated by Pete Kleine
pathsidewalkwalkway