Download free
two gray chairs on road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

two gray chairs on road

I was walking around the Luxembourg Gardens in Paris, and stumbled upon these curiously placed park chairs.

A map markerLuxembourg Gardens, Paris, France
Calendar outlinedPublished on CameraCanon, EOS 5D Mark III
SafetyFree to use under the Unsplash License
Paris pictures & imagesluxembourg gardensfrancechairparkFall images & picturesHd autumn wallpapersTree images & picturesHd city wallpaperscityscapechairsleavesfurniturepathHd grey wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Assortment
96 images · Curated by irene kendall
assortmentHd color wallpaperscolour
sustainability
37 images · Curated by Hannah Tolk
sustainabilityplantHd green wallpapers