Download free
two black-and-white birds perching on tree branch
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

two black-and-white birds perching on tree branch

White-breasted Woodswallow.

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
Birds imagesillustrationHistorical photos & imageswatercolourwoodswallowpairtwopaintingavesperchedavianHd art wallpapersHd grey wallpapersAnimals images & picturesPenguin pictures & imagesmagpieflyingvehicletransportationAirplane pictures & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Illustrations
64 images · Curated by Emmie Päivärinta
illustrationHd art wallpaperspainting
Illustrations
167 images · Curated by Phil Jones
illustrationHd art wallpaperspainting
Thuy 2
145 images · Curated by nicky hunt
plantFlower imagesblossom