Download free
trees near body of water during daytime
ā€“ā€“ā€“ ā€“ā€“ ā€“ā€“
ā€“ā€“ā€“ ā€“ā€“ā€“ā€“ ā€“ā€“ā€“ā€“
ā€“ā€“ā€“ ā€“ā€“ ā€“ā€“
ā€“ā€“ā€“ ā€“ā€“ā€“ā€“ ā€“ā€“ā€“ā€“

trees near body of water during daytime

Download this free HD photo of forest, land, summer, and blue in Mt Hood National Forest, USA by Sarah RK (@ardentlysarah)

A map markerBuck Lake, Mt Hood National Forest, USA
Calendar outlinedPublished on CameraApple, iPhone 5sSafetyFree to use under the Unsplash License
forestlandsummerbluegreenplantgreycampingleaveslakeusapeacecalmoutdoorsoregonvegetationpacific northwesttranquilitylogpnwPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20