Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Emily Kle's profile
Emily Kle
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
the sun is shining through the trees onto the water
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

the sun is shining through the trees onto the water

Download this free HD photo of sunset, green, mistery, and sea by Emily Kle (@m1ssfellow)

Calendar outlinedPublished on September 27, 2023 (UTC)SafetyFree to use under the Unsplash License
sunsetgreenmisteryseasummerlandgrassscenerylakeleafparkjunglerockrainforestsunlightsoiloutdoorsherbspondwildernessPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20