Download free
the night sky is filled with stars
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

the night sky is filled with stars

Download this free HD photo of black, infinite, night, and nightsky by Víctor Elvira Ávalos (@victor_011)

A map markerInfinite
Calendar outlinedPublished on CameraSONY, ILCE-7M2
SafetyFree to use under the Unsplash License
Hd black wallpapersinfinitenightnightskymilky wayHd sky wallpapersNature imagesoutdoorsastronomyOuter space picturesuniverseSpace images & picturesstarry skyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Kyya's Favourite
91 images · Curated by Undefined K
naturdraußengrau
Magazine
23 images · Curated by Erika Marie Ni Bhriain
magazinepersonahumano